No: | 04890000010 |
Sequence: | RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Amount: | 25ug/peptide |
Purity: | >80% (HPLC-MS) |
Appearance: | white to off-white powder |
Remark: | Every peptide in the peptide pools contains 15 amino-acid peptides spanning the complete amino acid sequence of the indicated protein.The peptides of this product are supplied as freeze-dried trifluoroacetate salts. For research use only. |
Storage conditions: | Store at - 20°C |